TAOK2 monoclonal antibody (M08), clone 2H6
  • TAOK2 monoclonal antibody (M08), clone 2H6

TAOK2 monoclonal antibody (M08), clone 2H6

Ref: AB-H00009344-M08
TAOK2 monoclonal antibody (M08), clone 2H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TAOK2.
Información adicional
Size 100 ug
Gene Name TAOK2
Gene Alias KIAA0881|MAP3K17|PSK|PSK1|TAO1|TAO2
Gene Description TAO kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TAOK2 (AAH51798, 831 a.a. ~ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9344
Clone Number 2H6
Iso type IgG2a Kappa

Enviar uma mensagem


TAOK2 monoclonal antibody (M08), clone 2H6

TAOK2 monoclonal antibody (M08), clone 2H6