SNAP29 purified MaxPab mouse polyclonal antibody (B01P)
  • SNAP29 purified MaxPab mouse polyclonal antibody (B01P)

SNAP29 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009342-B01P
SNAP29 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SNAP29 protein.
Información adicional
Size 50 ug
Gene Name SNAP29
Gene Alias CEDNIK|FLJ21051|SNAP-29
Gene Description synaptosomal-associated protein, 29kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNAP29 (NP_004773.1, 1 a.a. ~ 258 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9342

Enviar uma mensagem


SNAP29 purified MaxPab mouse polyclonal antibody (B01P)

SNAP29 purified MaxPab mouse polyclonal antibody (B01P)