TCEAL1 monoclonal antibody (M01), clone 3B9
  • TCEAL1 monoclonal antibody (M01), clone 3B9

TCEAL1 monoclonal antibody (M01), clone 3B9

Ref: AB-H00009338-M01
TCEAL1 monoclonal antibody (M01), clone 3B9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TCEAL1.
Información adicional
Size 100 ug
Gene Name TCEAL1
Gene Alias SIIR|p21|pp21
Gene Description transcription elongation factor A (SII)-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCEAL1 (AAH00809, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9338
Clone Number 3B9
Iso type IgG2a Kappa

Enviar uma mensagem


TCEAL1 monoclonal antibody (M01), clone 3B9

TCEAL1 monoclonal antibody (M01), clone 3B9