CNOT8 monoclonal antibody (M01), clone 1F11
  • CNOT8 monoclonal antibody (M01), clone 1F11

CNOT8 monoclonal antibody (M01), clone 1F11

Ref: AB-H00009337-M01
CNOT8 monoclonal antibody (M01), clone 1F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CNOT8.
Información adicional
Size 100 ug
Gene Name CNOT8
Gene Alias CAF1|CALIF|POP2|hCAF1
Gene Description CCR4-NOT transcription complex, subunit 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNOT8 (NP_004770.4, 201 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9337
Clone Number 1F11
Iso type IgG2a Kappa

Enviar uma mensagem


CNOT8 monoclonal antibody (M01), clone 1F11

CNOT8 monoclonal antibody (M01), clone 1F11