GTF3C3 polyclonal antibody (A01)
  • GTF3C3 polyclonal antibody (A01)

GTF3C3 polyclonal antibody (A01)

Ref: AB-H00009330-A01
GTF3C3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GTF3C3.
Información adicional
Size 50 uL
Gene Name GTF3C3
Gene Alias TFIIIC102|TFIIICgamma|TFiiiC2-102
Gene Description general transcription factor IIIC, polypeptide 3, 102kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TPEQPTAGDVFVLEMVLNRETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTF3C3 (NP_036218, 112 a.a. ~ 214 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9330

Enviar uma mensagem


GTF3C3 polyclonal antibody (A01)

GTF3C3 polyclonal antibody (A01)