GTF3C4 polyclonal antibody (A01)
  • GTF3C4 polyclonal antibody (A01)

GTF3C4 polyclonal antibody (A01)

Ref: AB-H00009329-A01
GTF3C4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GTF3C4.
Información adicional
Size 50 uL
Gene Name GTF3C4
Gene Alias FLJ21002|KAT12|MGC138450|TFIII90|TFIIIC90|TFIIICdelta|TFiiiC2-90
Gene Description general transcription factor IIIC, polypeptide 4, 90kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIARHPAPEDPDWIKRLLQSPCPFCDSPVF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTF3C4 (NP_036336, 723 a.a. ~ 822 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9329

Enviar uma mensagem


GTF3C4 polyclonal antibody (A01)

GTF3C4 polyclonal antibody (A01)