GTF3C5 monoclonal antibody (M01), clone 3F10
  • GTF3C5 monoclonal antibody (M01), clone 3F10

GTF3C5 monoclonal antibody (M01), clone 3F10

Ref: AB-H00009328-M01
GTF3C5 monoclonal antibody (M01), clone 3F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GTF3C5.
Información adicional
Size 100 ug
Gene Name GTF3C5
Gene Alias FLJ20857|TFIIIC63|TFIIICepsilon|TFiiiC2-63
Gene Description general transcription factor IIIC, polypeptide 5, 63kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq ARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHRNDGAENSCTERDGWCLPKTSDELRDTMSLMIRQTIRSKRPALFSSSAKADGGKEQLTYESG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTF3C5 (NP_036219, 378 a.a. ~ 485 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9328
Clone Number 3F10
Iso type IgG2a Kappa

Enviar uma mensagem


GTF3C5 monoclonal antibody (M01), clone 3F10

GTF3C5 monoclonal antibody (M01), clone 3F10