GTF3C5 purified MaxPab mouse polyclonal antibody (B01P)
  • GTF3C5 purified MaxPab mouse polyclonal antibody (B01P)

GTF3C5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009328-B01P
GTF3C5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GTF3C5 protein.
Información adicional
Size 50 ug
Gene Name GTF3C5
Gene Alias FLJ20857|TFIIIC63|TFIIICepsilon|TFiiiC2-63
Gene Description general transcription factor IIIC, polypeptide 5, 63kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAAEAADLGLGAAVPVELRRERRMVCVEYPGVVRDVAKMLPTLGGEEGVSRIYADPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGGKHTSMYDKVLMLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRPETQHREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GTF3C5 (AAH17337.1, 1 a.a. ~ 519 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9328

Enviar uma mensagem


GTF3C5 purified MaxPab mouse polyclonal antibody (B01P)

GTF3C5 purified MaxPab mouse polyclonal antibody (B01P)