ZNHIT3 monoclonal antibody (M09), clone 2F8
  • ZNHIT3 monoclonal antibody (M09), clone 2F8

ZNHIT3 monoclonal antibody (M09), clone 2F8

Ref: AB-H00009326-M09
ZNHIT3 monoclonal antibody (M09), clone 2F8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ZNHIT3.
Información adicional
Size 100 ug
Gene Name ZNHIT3
Gene Alias TRIP3
Gene Description zinc finger, HIT type 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNHIT3 (AAH17931, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9326
Clone Number 2F8
Iso type IgG1 Kappa

Enviar uma mensagem


ZNHIT3 monoclonal antibody (M09), clone 2F8

ZNHIT3 monoclonal antibody (M09), clone 2F8