KLF4 monoclonal antibody (M02), clone X1
  • KLF4 monoclonal antibody (M02), clone X1

KLF4 monoclonal antibody (M02), clone X1

Ref: AB-H00009314-M02
KLF4 monoclonal antibody (M02), clone X1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLF4.
Información adicional
Size 100 ug
Gene Name KLF4
Gene Alias EZF|GKLF
Gene Description Kruppel-like factor 4 (gut)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq VLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF4 (AAH29923, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9314
Clone Number X1
Iso type IgG1 Kappa

Enviar uma mensagem


KLF4 monoclonal antibody (M02), clone X1

KLF4 monoclonal antibody (M02), clone X1