KLF4 polyclonal antibody (A01)
  • KLF4 polyclonal antibody (A01)

KLF4 polyclonal antibody (A01)

Ref: AB-H00009314-A01
KLF4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KLF4.
Información adicional
Size 50 uL
Gene Name KLF4
Gene Alias EZF|GKLF
Gene Description Kruppel-like factor 4 (gut)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF4 (AAH29923, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9314

Enviar uma mensagem


KLF4 polyclonal antibody (A01)

KLF4 polyclonal antibody (A01)