CD83 monoclonal antibody (M02), clone 3F3
  • CD83 monoclonal antibody (M02), clone 3F3

CD83 monoclonal antibody (M02), clone 3F3

Ref: AB-H00009308-M02
CD83 monoclonal antibody (M02), clone 3F3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CD83.
Información adicional
Size 100 ug
Gene Name CD83
Gene Alias BL11|HB15
Gene Description CD83 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD83 (AAH30830, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9308
Clone Number 3F3
Iso type IgG2a kappa

Enviar uma mensagem


CD83 monoclonal antibody (M02), clone 3F3

CD83 monoclonal antibody (M02), clone 3F3