CD83 polyclonal antibody (A01)
  • CD83 polyclonal antibody (A01)

CD83 polyclonal antibody (A01)

Ref: AB-H00009308-A01
CD83 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CD83.
Información adicional
Size 50 uL
Gene Name CD83
Gene Alias BL11|HB15
Gene Description CD83 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD83 (AAH30830, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9308

Enviar uma mensagem


CD83 polyclonal antibody (A01)

CD83 polyclonal antibody (A01)