BCL7C monoclonal antibody (M02), clone 1A4
  • BCL7C monoclonal antibody (M02), clone 1A4

BCL7C monoclonal antibody (M02), clone 1A4

Ref: AB-H00009274-M02
BCL7C monoclonal antibody (M02), clone 1A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BCL7C.
Información adicional
Size 100 ug
Gene Name BCL7C
Gene Alias -
Gene Description B-cell CLL/lymphoma 7C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq PLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCL7C (NP_004756, 86 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9274
Clone Number 1A4
Iso type IgG2b Kappa

Enviar uma mensagem


BCL7C monoclonal antibody (M02), clone 1A4

BCL7C monoclonal antibody (M02), clone 1A4