CYTH2 monoclonal antibody (M02), clone 6H5
  • CYTH2 monoclonal antibody (M02), clone 6H5

CYTH2 monoclonal antibody (M02), clone 6H5

Ref: AB-H00009266-M02
CYTH2 monoclonal antibody (M02), clone 6H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CYTH2.
Información adicional
Size 100 ug
Gene Name CYTH2
Gene Alias ARNO|CTS18|CTS18.1|PSCD2|PSCD2L|SEC7L|Sec7p-L|Sec7p-like
Gene Description cytohesin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq VDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYTH2 (NP_059431, 314 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9266
Clone Number 6H5
Iso type IgG2a Kappa

Enviar uma mensagem


CYTH2 monoclonal antibody (M02), clone 6H5

CYTH2 monoclonal antibody (M02), clone 6H5