CYTH3 monoclonal antibody (M01A), clone S1
  • CYTH3 monoclonal antibody (M01A), clone S1

CYTH3 monoclonal antibody (M01A), clone S1

Ref: AB-H00009265-M01A
CYTH3 monoclonal antibody (M01A), clone S1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CYTH3.
Información adicional
Size 200 uL
Gene Name CYTH3
Gene Alias ARNO3|GRP1|PSCD3
Gene Description cytohesin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYTH3 (AAH08191.1, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 9265
Clone Number S1
Iso type IgG2b Kappa

Enviar uma mensagem


CYTH3 monoclonal antibody (M01A), clone S1

CYTH3 monoclonal antibody (M01A), clone S1