PSCD3 monoclonal antibody (M01), clone 6D3-1A9
  • PSCD3 monoclonal antibody (M01), clone 6D3-1A9

PSCD3 monoclonal antibody (M01), clone 6D3-1A9

Ref: AB-H00009265-M01
PSCD3 monoclonal antibody (M01), clone 6D3-1A9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PSCD3.
Información adicional
Size 100 ug
Gene Name CYTH3
Gene Alias ARNO3|GRP1|PSCD3
Gene Description cytohesin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSCD3 (AAH08191, 1 a.a. ~ 180 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9265
Clone Number 6D3-1A9
Iso type IgG2b kappa

Enviar uma mensagem


PSCD3 monoclonal antibody (M01), clone 6D3-1A9

PSCD3 monoclonal antibody (M01), clone 6D3-1A9