STK17A MaxPab mouse polyclonal antibody (B01P)
  • STK17A MaxPab mouse polyclonal antibody (B01P)

STK17A MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009263-B01P
STK17A MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human STK17A protein.
Información adicional
Size 50 ug
Gene Name STK17A
Gene Alias DRAK1
Gene Description serine/threonine kinase 17a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVVRTEPFQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STK17A (AAH47696.1, 1 a.a. ~ 414 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9263

Enviar uma mensagem


STK17A MaxPab mouse polyclonal antibody (B01P)

STK17A MaxPab mouse polyclonal antibody (B01P)