NOG purified MaxPab mouse polyclonal antibody (B01P)
  • NOG purified MaxPab mouse polyclonal antibody (B01P)

NOG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009241-B01P
NOG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NOG protein.
Información adicional
Size 50 ug
Gene Name NOG
Gene Alias SYM1|SYNS1
Gene Description noggin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOG (NP_005441.1, 1 a.a. ~ 232 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9241

Enviar uma mensagem


NOG purified MaxPab mouse polyclonal antibody (B01P)

NOG purified MaxPab mouse polyclonal antibody (B01P)