TBRG4 purified MaxPab mouse polyclonal antibody (B01P)
  • TBRG4 purified MaxPab mouse polyclonal antibody (B01P)

TBRG4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009238-B01P
TBRG4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TBRG4 protein.
Información adicional
Size 50 ug
Gene Name TBRG4
Gene Alias CPR2|FASTKD4|KIAA0948
Gene Description transforming growth factor beta regulator 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAAHLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKPEDKGLLIQDAHFHQLLCLLNSQIASVWHGTLSKLLGSLYALGIPKASKELQSVEQEVRWRMRKLKYKHLAFLAESCATLSQEQHSQELLAELLTHLERRWTEIEDSHTLVTVMMKVGHLSEPLMNRLEDKCLELVEHFGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TBRG4 (NP_004740.2, 1 a.a. ~ 631 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9238

Enviar uma mensagem


TBRG4 purified MaxPab mouse polyclonal antibody (B01P)

TBRG4 purified MaxPab mouse polyclonal antibody (B01P)