PTTG1 monoclonal antibody (M01), clone 1D9
  • PTTG1 monoclonal antibody (M01), clone 1D9

PTTG1 monoclonal antibody (M01), clone 1D9

Ref: AB-H00009232-M01
PTTG1 monoclonal antibody (M01), clone 1D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTTG1.
Información adicional
Size 100 ug
Gene Name PTTG1
Gene Alias EAP1|HPTTG|MGC126883|MGC138276|PTTG|TUTR1
Gene Description pituitary tumor-transforming 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTTG1 (NP_004210, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9232
Clone Number 1D9
Iso type IgG1 Kappa

Enviar uma mensagem


PTTG1 monoclonal antibody (M01), clone 1D9

PTTG1 monoclonal antibody (M01), clone 1D9