LRAT monoclonal antibody (M05), clone 4E12
  • LRAT monoclonal antibody (M05), clone 4E12

LRAT monoclonal antibody (M05), clone 4E12

Ref: AB-H00009227-M05
LRAT monoclonal antibody (M05), clone 4E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LRAT.
Información adicional
Size 100 ug
Gene Name LRAT
Gene Alias MGC33103
Gene Description lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAYGANILVNHLDESLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LRAT (NP_004735.2, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9227
Clone Number 4E12
Iso type IgG2a Kappa

Enviar uma mensagem


LRAT monoclonal antibody (M05), clone 4E12

LRAT monoclonal antibody (M05), clone 4E12