VAPA purified MaxPab mouse polyclonal antibody (B01P)
  • VAPA purified MaxPab mouse polyclonal antibody (B01P)

VAPA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009218-B01P
VAPA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human VAPA protein.
Información adicional
Size 50 ug
Gene Name VAPA
Gene Alias MGC3745|VAP-33|VAP-A|VAP33|hVAP-33
Gene Description VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VAPA (ENSP00000217602, 1 a.a. ~ 242 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9218

Enviar uma mensagem


VAPA purified MaxPab mouse polyclonal antibody (B01P)

VAPA purified MaxPab mouse polyclonal antibody (B01P)