FAIM3 purified MaxPab rabbit polyclonal antibody (D01P)
  • FAIM3 purified MaxPab rabbit polyclonal antibody (D01P)

FAIM3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009214-D01P
FAIM3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FAIM3 protein.
Información adicional
Size 100 ug
Gene Name FAIM3
Gene Alias TOSO
Gene Description Fas apoptotic inhibitory molecule 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREGQGFHIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FAIM3 (NP_005440.1, 1 a.a. ~ 390 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9214

Enviar uma mensagem


FAIM3 purified MaxPab rabbit polyclonal antibody (D01P)

FAIM3 purified MaxPab rabbit polyclonal antibody (D01P)