LRRFIP1 monoclonal antibody (M01), clone 4E11
  • LRRFIP1 monoclonal antibody (M01), clone 4E11

LRRFIP1 monoclonal antibody (M01), clone 4E11

Ref: AB-H00009208-M01
LRRFIP1 monoclonal antibody (M01), clone 4E11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant LRRFIP1.
Información adicional
Size 100 ug
Gene Name LRRFIP1
Gene Alias FLAP-1|FLIIAP1|GCF-2|GCF2|HUFI-1|MGC10947|MGC119738|MGC119739|TRIP
Gene Description leucine rich repeat (in FLII) interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LRRFIP1 (AAH10662, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9208
Clone Number 4E11
Iso type IgG1 Kappa

Enviar uma mensagem


LRRFIP1 monoclonal antibody (M01), clone 4E11

LRRFIP1 monoclonal antibody (M01), clone 4E11