SLC33A1 monoclonal antibody (M07), clone 3A4
  • SLC33A1 monoclonal antibody (M07), clone 3A4

SLC33A1 monoclonal antibody (M07), clone 3A4

Ref: AB-H00009197-M07
SLC33A1 monoclonal antibody (M07), clone 3A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC33A1.
Información adicional
Size 100 ug
Gene Name SLC33A1
Gene Alias ACATN|AT-1|AT1|SPG42
Gene Description solute carrier family 33 (acetyl-CoA transporter), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC33A1 (NP_004724, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9197
Clone Number 3A4
Iso type IgG2a Kappa

Enviar uma mensagem


SLC33A1 monoclonal antibody (M07), clone 3A4

SLC33A1 monoclonal antibody (M07), clone 3A4