ZW10 MaxPab mouse polyclonal antibody (B01P)
  • ZW10 MaxPab mouse polyclonal antibody (B01P)

ZW10 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009183-B01P
ZW10 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZW10 protein.
Información adicional
Size 50 ug
Gene Name ZW10
Gene Alias HZW10|KNTC1AP|MGC149821
Gene Description ZW10, kinetochore associated, homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MASFVTEVLAHSGRLEKEDLGTRISRLTRRVEEIKGEVCNMISKKYSEFLPSMQSAQGLITQVDKLSEDIDLLKSRIESEVRRDLHVSTGEFTDLKQQLERDSVVLSLLKQLQEFSTAIEEYNCALTEKKYVTGAQRLEEAQKCLKLLKSRKCFDLKILKSLSMELTIQKQNILYHLGEEWQKLIVWKFPPSKDTSSLESYLQTELHLYTEQSHKEEKTPMPPISSVLLAFSVLGELHSKLKSFGQMLLKYILRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZW10 (NP_004715, 1 a.a. ~ 779 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9183

Enviar uma mensagem


ZW10 MaxPab mouse polyclonal antibody (B01P)

ZW10 MaxPab mouse polyclonal antibody (B01P)