OSMR purified MaxPab rabbit polyclonal antibody (D01P)
  • OSMR purified MaxPab rabbit polyclonal antibody (D01P)

OSMR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009180-D01P
OSMR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human OSMR protein.
Información adicional
Size 100 ug
Gene Name OSMR
Gene Alias MGC150626|MGC150627|MGC75127|OSMRB
Gene Description oncostatin M receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OSMR (AAH10943.1, 1 a.a. ~ 342 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9180

Enviar uma mensagem


OSMR purified MaxPab rabbit polyclonal antibody (D01P)

OSMR purified MaxPab rabbit polyclonal antibody (D01P)