OSMR MaxPab rabbit polyclonal antibody (D01)
  • OSMR MaxPab rabbit polyclonal antibody (D01)

OSMR MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009180-D01
OSMR MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human OSMR protein.
Información adicional
Size 100 uL
Gene Name OSMR
Gene Alias MGC150626|MGC150627|MGC75127|OSMRB
Gene Description oncostatin M receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OSMR (AAH10943.1, 1 a.a. ~ 342 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9180

Enviar uma mensagem


OSMR MaxPab rabbit polyclonal antibody (D01)

OSMR MaxPab rabbit polyclonal antibody (D01)