AP4M1 purified MaxPab rabbit polyclonal antibody (D01P)
  • AP4M1 purified MaxPab rabbit polyclonal antibody (D01P)

AP4M1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009179-D01P
AP4M1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AP4M1 protein.
Información adicional
Size 100 ug
Gene Name AP4M1
Gene Alias MU-4|MU-ARP2
Gene Description adaptor-related protein complex 4, mu 1 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHHGRHFIHIRHSGLYLVVTTSENVSPFSLLELLSRLATLLGDYCGSLGEGTISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AP4M1 (NP_004713.2, 1 a.a. ~ 453 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9179

Enviar uma mensagem


AP4M1 purified MaxPab rabbit polyclonal antibody (D01P)

AP4M1 purified MaxPab rabbit polyclonal antibody (D01P)