MAP3K13 monoclonal antibody (M04), clone 4H7
  • MAP3K13 monoclonal antibody (M04), clone 4H7

MAP3K13 monoclonal antibody (M04), clone 4H7

Ref: AB-H00009175-M04
MAP3K13 monoclonal antibody (M04), clone 4H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP3K13.
Información adicional
Size 100 ug
Gene Name MAP3K13
Gene Alias LZK|MGC133196
Gene Description mitogen-activated protein kinase kinase kinase 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq SEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP3K13 (NP_004712.1, 711 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9175
Clone Number 4H7
Iso type IgG2a Kappa

Enviar uma mensagem


MAP3K13 monoclonal antibody (M04), clone 4H7

MAP3K13 monoclonal antibody (M04), clone 4H7