DYRK1B monoclonal antibody (M10), clone 2E8
  • DYRK1B monoclonal antibody (M10), clone 2E8

DYRK1B monoclonal antibody (M10), clone 2E8

Ref: AB-H00009149-M10
DYRK1B monoclonal antibody (M10), clone 2E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DYRK1B.
Información adicional
Size 100 ug
Gene Name DYRK1B
Gene Alias MIRK
Gene Description dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DYRK1B (AAH25291, 479 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9149
Clone Number 2E8
Iso type IgG2a Kappa

Enviar uma mensagem


DYRK1B monoclonal antibody (M10), clone 2E8

DYRK1B monoclonal antibody (M10), clone 2E8