DYRK1B purified MaxPab rabbit polyclonal antibody (D01P)
  • DYRK1B purified MaxPab rabbit polyclonal antibody (D01P)

DYRK1B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009149-D01P
DYRK1B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DYRK1B protein.
Información adicional
Size 100 ug
Gene Name DYRK1B
Gene Alias MIRK
Gene Description dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DYRK1B (NP_004705.1, 1 a.a. ~ 629 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9149

Enviar uma mensagem


DYRK1B purified MaxPab rabbit polyclonal antibody (D01P)

DYRK1B purified MaxPab rabbit polyclonal antibody (D01P)