HGS purified MaxPab mouse polyclonal antibody (B01P)
  • HGS purified MaxPab mouse polyclonal antibody (B01P)

HGS purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009146-B01P
HGS purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HGS protein.
Información adicional
Size 50 ug
Gene Name HGS
Gene Alias HRS|ZFYVE8
Gene Description hepatocyte growth factor-regulated tyrosine kinase substrate
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HGS (NP_004703.1, 1 a.a. ~ 777 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9146

Enviar uma mensagem


HGS purified MaxPab mouse polyclonal antibody (B01P)

HGS purified MaxPab mouse polyclonal antibody (B01P)