HGS polyclonal antibody (A01)
  • HGS polyclonal antibody (A01)

HGS polyclonal antibody (A01)

Ref: AB-H00009146-A01
HGS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HGS.
Información adicional
Size 50 uL
Gene Name HGS
Gene Alias HRS|ZFYVE8
Gene Description hepatocyte growth factor-regulated tyrosine kinase substrate
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HGS (AAH03565, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9146

Enviar uma mensagem


HGS polyclonal antibody (A01)

HGS polyclonal antibody (A01)