CBFA2T2 monoclonal antibody (M07), clone 3G8
  • CBFA2T2 monoclonal antibody (M07), clone 3G8

CBFA2T2 monoclonal antibody (M07), clone 3G8

Ref: AB-H00009139-M07
CBFA2T2 monoclonal antibody (M07), clone 3G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CBFA2T2.
Información adicional
Size 100 ug
Gene Name CBFA2T2
Gene Alias DKFZp313F2116|EHT|MTGR1|ZMYND3
Gene Description core-binding factor, runt domain, alpha subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CBFA2T2 (NP_001028171.1, 201 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9139
Clone Number 3G8
Iso type IgG2b Kappa

Enviar uma mensagem


CBFA2T2 monoclonal antibody (M07), clone 3G8

CBFA2T2 monoclonal antibody (M07), clone 3G8