PDCD8 polyclonal antibody (A01)
  • PDCD8 polyclonal antibody (A01)

PDCD8 polyclonal antibody (A01)

Ref: AB-H00009131-A01
PDCD8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDCD8.
Información adicional
Size 50 uL
Gene Name AIFM1
Gene Alias AIF|MGC111425|PDCD8
Gene Description apoptosis-inducing factor, mitochondrion-associated, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDCD8 (NP_004199, 420 a.a. ~ 529 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9131

Enviar uma mensagem


PDCD8 polyclonal antibody (A01)

PDCD8 polyclonal antibody (A01)