FAM50A monoclonal antibody (M02), clone 5F10
  • FAM50A monoclonal antibody (M02), clone 5F10

FAM50A monoclonal antibody (M02), clone 5F10

Ref: AB-H00009130-M02
FAM50A monoclonal antibody (M02), clone 5F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FAM50A.
Información adicional
Size 100 ug
Gene Name FAM50A
Gene Alias 9F|DXS9928E|HXC-26|XAP5
Gene Description family with sequence similarity 50, member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FAM50A (NP_004690, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9130
Clone Number 5F10
Iso type IgG2a Kappa

Enviar uma mensagem


FAM50A monoclonal antibody (M02), clone 5F10

FAM50A monoclonal antibody (M02), clone 5F10