LATS1 monoclonal antibody (M09), clone 3A7
  • LATS1 monoclonal antibody (M09), clone 3A7

LATS1 monoclonal antibody (M09), clone 3A7

Ref: AB-H00009113-M09
LATS1 monoclonal antibody (M09), clone 3A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LATS1.
Información adicional
Size 100 ug
Gene Name LATS1
Gene Alias WARTS|wts
Gene Description LATS, large tumor suppressor, homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LATS1 (NP_004681, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9113
Clone Number 3A7
Iso type IgG2a Kappa

Enviar uma mensagem


LATS1 monoclonal antibody (M09), clone 3A7

LATS1 monoclonal antibody (M09), clone 3A7