LATS1 monoclonal antibody (M09), clone 3A7 View larger

Mouse monoclonal antibody raised against a partial recombinant LATS1.

AB-H00009113-M09

New product

LATS1 monoclonal antibody (M09), clone 3A7

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name LATS1
Gene Alias WARTS|wts
Gene Description LATS, large tumor suppressor, homolog 1 (Drosophila)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LATS1 (NP_004681, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9113
Clone Number 3A7
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant LATS1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant LATS1.

Mouse monoclonal antibody raised against a partial recombinant LATS1.