MTA1 monoclonal antibody (M01), clone 4D5
  • MTA1 monoclonal antibody (M01), clone 4D5

MTA1 monoclonal antibody (M01), clone 4D5

Ref: AB-H00009112-M01
MTA1 monoclonal antibody (M01), clone 4D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MTA1.
Información adicional
Size 100 ug
Gene Name MTA1
Gene Alias -
Gene Description metastasis associated 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTA1 (NP_004680, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9112
Clone Number 4D5
Iso type IgG3 Kappa

Enviar uma mensagem


MTA1 monoclonal antibody (M01), clone 4D5

MTA1 monoclonal antibody (M01), clone 4D5