NMI purified MaxPab rabbit polyclonal antibody (D01P)
  • NMI purified MaxPab rabbit polyclonal antibody (D01P)

NMI purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009111-D01P
NMI purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NMI protein.
Información adicional
Size 100 ug
Gene Name NMI
Gene Alias -
Gene Description N-myc (and STAT) interactor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLRKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NMI (AAH21987.1, 1 a.a. ~ 307 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9111

Enviar uma mensagem


NMI purified MaxPab rabbit polyclonal antibody (D01P)

NMI purified MaxPab rabbit polyclonal antibody (D01P)