NMI MaxPab rabbit polyclonal antibody (D01)
  • NMI MaxPab rabbit polyclonal antibody (D01)

NMI MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009111-D01
NMI MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NMI protein.
Información adicional
Size 100 uL
Gene Name NMI
Gene Alias -
Gene Description N-myc (and STAT) interactor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLRKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NMI (AAH21987.1, 1 a.a. ~ 307 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9111

Enviar uma mensagem


NMI MaxPab rabbit polyclonal antibody (D01)

NMI MaxPab rabbit polyclonal antibody (D01)