RGN monoclonal antibody (M04), clone 4B9
  • RGN monoclonal antibody (M04), clone 4B9

RGN monoclonal antibody (M04), clone 4B9

Ref: AB-H00009104-M04
RGN monoclonal antibody (M04), clone 4B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RGN.
Información adicional
Size 100 ug
Gene Name RGN
Gene Alias RC|SMP30
Gene Description regucalcin (senescence marker protein-30)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGN (NP_004674.1, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9104
Clone Number 4B9
Iso type IgG2a Kappa

Enviar uma mensagem


RGN monoclonal antibody (M04), clone 4B9

RGN monoclonal antibody (M04), clone 4B9