USP10 purified MaxPab mouse polyclonal antibody (B01P)
  • USP10 purified MaxPab mouse polyclonal antibody (B01P)

USP10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009100-B01P
USP10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human USP10 protein.
Información adicional
Size 50 ug
Gene Name USP10
Gene Alias KIAA0190|MGC2621|UBPO
Gene Description ubiquitin specific peptidase 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MALHSPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDGQEYQRIEFGVDEVIEPSDTLPRTPSYSISSTLNPQAPEFILGCTASKITPDGITKEASYGSIDCQYPGSALALDGSSNVEAEVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPPPLTPRTCNSPQNSTDSVSDIVPDSPFPGALGSDTRTAGQPEGGPGADFGQSCF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP10 (AAH00263.1, 1 a.a. ~ 798 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9100

Enviar uma mensagem


USP10 purified MaxPab mouse polyclonal antibody (B01P)

USP10 purified MaxPab mouse polyclonal antibody (B01P)