USP6 monoclonal antibody (M01), clone 1F5
  • USP6 monoclonal antibody (M01), clone 1F5

USP6 monoclonal antibody (M01), clone 1F5

Ref: AB-H00009098-M01
USP6 monoclonal antibody (M01), clone 1F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP6.
Información adicional
Size 100 ug
Gene Name USP6
Gene Alias HRP1|TRE17|TRE2|Tre-2
Gene Description ubiquitin specific peptidase 6 (Tre-2 oncogene)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP6 (NP_004496, 2 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9098
Clone Number 1F5
Iso type IgG2a Kappa

Enviar uma mensagem


USP6 monoclonal antibody (M01), clone 1F5

USP6 monoclonal antibody (M01), clone 1F5