USP14 purified MaxPab rabbit polyclonal antibody (D01P)
  • USP14 purified MaxPab rabbit polyclonal antibody (D01P)

USP14 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009097-D01P
USP14 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human USP14 protein.
Información adicional
Size 100 ug
Gene Name USP14
Gene Alias TGT
Gene Description ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP14 (NP_005142.1, 1 a.a. ~ 494 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9097

Enviar uma mensagem


USP14 purified MaxPab rabbit polyclonal antibody (D01P)

USP14 purified MaxPab rabbit polyclonal antibody (D01P)