USP14 polyclonal antibody (A01)
  • USP14 polyclonal antibody (A01)

USP14 polyclonal antibody (A01)

Ref: AB-H00009097-A01
USP14 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant USP14.
Información adicional
Size 50 uL
Gene Name USP14
Gene Alias TGT
Gene Description ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP14 (NP_005142, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9097

Enviar uma mensagem


USP14 polyclonal antibody (A01)

USP14 polyclonal antibody (A01)