UNC119 MaxPab rabbit polyclonal antibody (D01)
  • UNC119 MaxPab rabbit polyclonal antibody (D01)

UNC119 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009094-D01
UNC119 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UNC119 protein.
Información adicional
Size 100 uL
Gene Name UNC119
Gene Alias HRG4
Gene Description unc-119 homolog (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UNC119 (NP_005139.1, 1 a.a. ~ 240 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9094

Enviar uma mensagem


UNC119 MaxPab rabbit polyclonal antibody (D01)

UNC119 MaxPab rabbit polyclonal antibody (D01)