ASH2L monoclonal antibody (M09), clone 4G7
  • ASH2L monoclonal antibody (M09), clone 4G7

ASH2L monoclonal antibody (M09), clone 4G7

Ref: AB-H00009070-M09
ASH2L monoclonal antibody (M09), clone 4G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ASH2L.
Información adicional
Size 100 ug
Gene Name ASH2L
Gene Alias ASH2|ASH2L1|ASH2L2|Bre2
Gene Description ash2 (absent, small, or homeotic)-like (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ASH2L (NP_004665.1, 424 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9070
Clone Number 4G7
Iso type IgG2a Kappa

Enviar uma mensagem


ASH2L monoclonal antibody (M09), clone 4G7

ASH2L monoclonal antibody (M09), clone 4G7