SYT7 monoclonal antibody (M01), clone 4H4
  • SYT7 monoclonal antibody (M01), clone 4H4

SYT7 monoclonal antibody (M01), clone 4H4

Ref: AB-H00009066-M01
SYT7 monoclonal antibody (M01), clone 4H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SYT7.
Información adicional
Size 100 ug
Gene Name SYT7
Gene Alias IPCA-7|MGC150517|PCANAP7|SYT-VII
Gene Description synaptotagmin VII
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CQRKLGKRYKNSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SYT7 (NP_004191.2, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9066
Clone Number 4H4
Iso type IgG2a Kappa

Enviar uma mensagem


SYT7 monoclonal antibody (M01), clone 4H4

SYT7 monoclonal antibody (M01), clone 4H4